Lineage for d3eymf_ (3eym F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645612Domain d3eymf_: 3eym F: [239269]
    Other proteins in same PDB: d3eyma_, d3eymc_, d3eyme_
    automated match to d1qfub_
    complexed with eyk

Details for d3eymf_

PDB Entry: 3eym (more details), 2.8 Å

PDB Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3eymf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eymf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d3eymf_:

Click to download the PDB-style file with coordinates for d3eymf_.
(The format of our PDB-style files is described here.)

Timeline for d3eymf_: