SCOPe 2.07: Domain d3eykb_: 3eyk B:

Lineage for d3eykb_ (3eyk B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)

8. Domain d3eykb_: 3eyk B: [239266]
   Other proteins in same PDB: d3eyka_
   automated match to d1qfub_
   complexed with eyk

Details for d3eykb_

PDB Entry: 3eyk, 2.5 Å

PDB Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3eykb_:

Sequence; same for both SEQRES and ATOM records:

>d3eykb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
ekyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedqgngcfeifhqcdnnciesirngtydhniyrdeainnrik

Timeline for d3eykb_:

• d3eykb_ first appeared in SCOPe 2.04
  
• d3eykb_ appears in SCOPe 2.06
  
• d3eykb_ appears in the current release, SCOPe 2.08