Lineage for d3eyjb_ (3eyj B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041694Domain d3eyjb_: 3eyj B: [239265]
    Other proteins in same PDB: d3eyja_
    automated match to d1qfub_

Details for d3eyjb_

PDB Entry: 3eyj (more details), 2.6 Å

PDB Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3eyjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eyjb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
ekyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedqgngcfeifhqcdnnciesirngtydhniyrdeainnrik

SCOPe Domain Coordinates for d3eyjb_:

Click to download the PDB-style file with coordinates for d3eyjb_.
(The format of our PDB-style files is described here.)

Timeline for d3eyjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eyja_