Lineage for d1p35b_ (1p35 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778259Fold b.28: Baculovirus p35 protein [49893] (1 superfamily)
    sandwich; 14 strands in 2 sheets; greek-key
  4. 2778260Superfamily b.28.1: Baculovirus p35 protein [49894] (1 family) (S)
    has a few helices inserted in loops
    automatically mapped to Pfam PF02331
  5. 2778261Family b.28.1.1: Baculovirus p35 protein [49895] (1 protein)
  6. 2778262Protein Baculovirus p35 protein [49896] (1 species)
    Apoptotic caspase inhibitor
  7. 2778263Species AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId:46015] [49897] (5 PDB entries)
  8. 2778265Domain d1p35b_: 1p35 B: [23926]
    complexed with edo, po4

Details for d1p35b_

PDB Entry: 1p35 (more details), 2.2 Å

PDB Description: crystal structure of baculovirus p35
PDB Compounds: (B:) p35

SCOPe Domain Sequences for d1p35b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p35b_ b.28.1.1 (B:) Baculovirus p35 protein {AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId: 46015]}
cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik

SCOPe Domain Coordinates for d1p35b_:

Click to download the PDB-style file with coordinates for d1p35b_.
(The format of our PDB-style files is described here.)

Timeline for d1p35b_: