![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.28: Baculovirus p35 protein [49893] (1 superfamily) sandwich; 14 strands in 2 sheets; greek-key |
![]() | Superfamily b.28.1: Baculovirus p35 protein [49894] (1 family) ![]() has a few helices inserted in loops automatically mapped to Pfam PF02331 |
![]() | Family b.28.1.1: Baculovirus p35 protein [49895] (1 protein) |
![]() | Protein Baculovirus p35 protein [49896] (1 species) Apoptotic caspase inhibitor |
![]() | Species AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId:46015] [49897] (5 PDB entries) |
![]() | Domain d1p35b_: 1p35 B: [23926] complexed with edo, po4 |
PDB Entry: 1p35 (more details), 2.2 Å
SCOPe Domain Sequences for d1p35b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p35b_ b.28.1.1 (B:) Baculovirus p35 protein {AcMNPV (Autographa californica nuclear polyhedrosis virus) [TaxId: 46015]} cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
Timeline for d1p35b_: