SCOPe 2.06: Domain d3eubl1: 3eub L:571-694

Lineage for d3eubl1 (3eub L:571-694)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)

8. Domain d3eubl1: 3eub L:571-694 [239256]
   Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub32, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubb2, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubk2, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubt2, d3eubu2
   automated match to d3eub41
   complexed with fad, fes, mom, mte, xan

Details for d3eubl1

PDB Entry: 3eub, 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine

PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eubl1:

Sequence; same for both SEQRES and ATOM records:

>d3eubl1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3eubl1:

• d3eubl1 first appeared in SCOPe 2.04
  
• d3eubl1 appears in SCOPe 2.05
  
• d3eubl1 appears in SCOPe 2.07
  
• d3eubl1 appears in the current release, SCOPe 2.08