Lineage for d3etra2 (3etr A:93-165)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493241Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1493242Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1493243Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1493321Protein automated matches [232101] (1 species)
    not a true protein
  7. 1493322Species Cow (Bos taurus) [TaxId:9913] [232106] (9 PDB entries)
  8. 1493335Domain d3etra2: 3etr A:93-165 [239250]
    Other proteins in same PDB: d3etra1, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrm1, d3etrm2, d3etrn1, d3etrn2
    automated match to d3etrl2
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etra2

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etra2 a.56.1.1 (A:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3etra2:

Click to download the PDB-style file with coordinates for d3etra2.
(The format of our PDB-style files is described here.)

Timeline for d3etra2: