Lineage for d3ejzb_ (3ejz B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024422Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 3024423Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 3024424Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 3024472Protein automated matches [226846] (4 species)
    not a true protein
  7. 3024515Species Escherichia coli [TaxId:562] [255156] (2 PDB entries)
  8. 3024517Domain d3ejzb_: 3ejz B: [239249]
    Other proteins in same PDB: d3ejzc_, d3ejzd1, d3ejzd2, d3ejze_, d3ejzf1, d3ejzf2
    automated match to d1kpla_
    complexed with br; mutant

Details for d3ejzb_

PDB Entry: 3ejz (more details), 2.9 Å

PDB Description: structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d3ejzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejzb_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiievmrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d3ejzb_:

Click to download the PDB-style file with coordinates for d3ejzb_.
(The format of our PDB-style files is described here.)

Timeline for d3ejzb_: