SCOPe 2.04: Domain d3ejza_: 3ejz A:

Lineage for d3ejza_ (3ejz A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein automated matches [226846] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255156] (2 PDB entries)

8. Domain d3ejza_: 3ejz A: [239248]
   Other proteins in same PDB: d3ejzd1, d3ejzd2, d3ejzf1, d3ejzf2
   automated match to d1kpla_
   complexed with br; mutant

Details for d3ejza_

PDB Entry: 3ejz, 2.9 Å

PDB Description: structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1

PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d3ejza_:

Sequence; same for both SEQRES and ATOM records:

>d3ejza_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiievmrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

Timeline for d3ejza_:

• d3ejza_ is new in SCOPe 2.04-stable
  
• d3ejza_ appears in SCOPe 2.05
  
• d3ejza_ appears in the current release, SCOPe 2.08