Lineage for d3ejza_ (3ejz A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577731Species Escherichia coli [TaxId:562] [255156] (2 PDB entries)
  8. 2577732Domain d3ejza_: 3ejz A: [239248]
    Other proteins in same PDB: d3ejzd1, d3ejzd2, d3ejzf1, d3ejzf2
    automated match to d1kpla_
    complexed with br; mutant

Details for d3ejza_

PDB Entry: 3ejz (more details), 2.9 Å

PDB Description: Structure of E203V mutant E.coli Cl-/H+ exchanger, CLC-ec1
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d3ejza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejza_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiievmrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d3ejza_:

Click to download the PDB-style file with coordinates for d3ejza_.
(The format of our PDB-style files is described here.)

Timeline for d3ejza_: