Lineage for d3e6me_ (3e6m E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (71 species)
    not a true protein
  7. 2307530Species Silicibacter pomeroyi [TaxId:89184] [232048] (1 PDB entry)
  8. 2307532Domain d3e6me_: 3e6m E: [239240]
    automated match to d3e6ma_

Details for d3e6me_

PDB Entry: 3e6m (more details), 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.
PDB Compounds: (E:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6me_:

Sequence, based on SEQRES records: (download)

>d3e6me_ a.4.5.0 (E:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplind
fhaelvgnvdpdklqtcievlgeilkgktdy

Sequence, based on observed residues (ATOM records): (download)

>d3e6me_ a.4.5.0 (E:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisrkrtvvltrkgkkklaeisplindfhae
lvgnvdpdklqtcievlgeilkgktdy

SCOPe Domain Coordinates for d3e6me_:

Click to download the PDB-style file with coordinates for d3e6me_.
(The format of our PDB-style files is described here.)

Timeline for d3e6me_: