SCOPe 2.05: Domain d1cq3b_: 1cq3 B:

Lineage for d1cq3b_ (1cq3 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family)
   automatically mapped to Pfam PF02250

5. Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)

6. Protein Soluble secreted chemokine inhibitor, VCCI [49891] (1 species)

7. Species Cowpox virus [TaxId:10243] [49892] (1 PDB entry)

8. Domain d1cq3b_: 1cq3 B: [23924]

Details for d1cq3b_

PDB Entry: 1cq3, 1.85 Å

PDB Description: structure of a soluble secreted chemokine inhibitor, vcci, from cowpox virus

PDB Compounds: (B:) viral chemokine inhibitor

SCOPe Domain Sequences for d1cq3b_:

Sequence; same for both SEQRES and ATOM records:

>d1cq3b_ b.27.1.1 (B:) Soluble secreted chemokine inhibitor, VCCI {Cowpox virus [TaxId: 10243]}
sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt
tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm
ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr
igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv

Timeline for d1cq3b_:

• d1cq3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cq3b_ appears in SCOPe 2.04
  
• d1cq3b_ appears in SCOPe 2.06
  
• d1cq3b_ appears in the current release, SCOPe 2.08