![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) ![]() automatically mapped to Pfam PF02250 |
![]() | Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins) |
![]() | Protein Soluble secreted chemokine inhibitor, VCCI [49891] (1 species) |
![]() | Species Cowpox virus [TaxId:10243] [49892] (1 PDB entry) |
![]() | Domain d1cq3b_: 1cq3 B: [23924] |
PDB Entry: 1cq3 (more details), 1.85 Å
SCOPe Domain Sequences for d1cq3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cq3b_ b.27.1.1 (B:) Soluble secreted chemokine inhibitor, VCCI {Cowpox virus [TaxId: 10243]} sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv
Timeline for d1cq3b_: