Lineage for d1cq3b_ (1cq3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778245Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778246Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) (S)
    automatically mapped to Pfam PF02250
  5. 2778247Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (2 proteins)
  6. 2778248Protein Soluble secreted chemokine inhibitor, VCCI [49891] (1 species)
  7. 2778249Species Cowpox virus [TaxId:10243] [49892] (1 PDB entry)
  8. 2778251Domain d1cq3b_: 1cq3 B: [23924]

Details for d1cq3b_

PDB Entry: 1cq3 (more details), 1.85 Å

PDB Description: structure of a soluble secreted chemokine inhibitor, vcci, from cowpox virus
PDB Compounds: (B:) viral chemokine inhibitor

SCOPe Domain Sequences for d1cq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq3b_ b.27.1.1 (B:) Soluble secreted chemokine inhibitor, VCCI {Cowpox virus [TaxId: 10243]}
sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt
tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm
ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr
igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv

SCOPe Domain Coordinates for d1cq3b_:

Click to download the PDB-style file with coordinates for d1cq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1cq3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cq3a_