Lineage for d3e37a_ (3e37 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726313Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2726314Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2726315Species Human (Homo sapiens) [TaxId:9606] [69093] (13 PDB entries)
    Uniprot P49354
  8. 2726317Domain d3e37a_: 3e37 A: [239238]
    Other proteins in same PDB: d3e37b_
    automated match to d1d8da_
    complexed with ed5, zn

Details for d3e37a_

PDB Entry: 3e37 (more details), 1.8 Å

PDB Description: protein farnesyltransferase complexed with bisubstrate ethylenediamine scaffold inhibitor 5
PDB Compounds: (A:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOPe Domain Sequences for d3e37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e37a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhst

SCOPe Domain Coordinates for d3e37a_:

Click to download the PDB-style file with coordinates for d3e37a_.
(The format of our PDB-style files is described here.)

Timeline for d3e37a_: