Lineage for d3e08f_ (3e08 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754793Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 1754794Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 1754832Family a.266.1.0: automated matches [227197] (1 protein)
    not a true family
  6. 1754833Protein automated matches [226924] (2 species)
    not a true protein
  7. 1754851Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries)
  8. 1754861Domain d3e08f_: 3e08 F: [239235]
    automated match to d3e08a_
    complexed with hem, trp; mutant

Details for d3e08f_

PDB Entry: 3e08 (more details), 1.9 Å

PDB Description: h55s mutant xanthomonas campestris tryptophan 2,3-dioxygenase
PDB Compounds: (F:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d3e08f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e08f_ a.266.1.0 (F:) automated matches {Xanthomonas campestris [TaxId: 340]}
lrdlepgihtdlegrltyggylrldqllsaqqplsepahhdemlfiiqsqtselwlklla
helraaivhlqrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgf
qslqyryiefllgnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqq
yqardwtaahvaddtlrpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmr
vigfkrgtggssgvgflqqalaltffpelfdvrtsv

SCOPe Domain Coordinates for d3e08f_:

Click to download the PDB-style file with coordinates for d3e08f_.
(The format of our PDB-style files is described here.)

Timeline for d3e08f_: