Lineage for d3dxrb_ (3dxr B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038755Fold g.83: Tim10-like [144121] (1 superfamily)
    alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure
  4. 3038756Superfamily g.83.1: Tim10-like [144122] (2 families) (S)
  5. 3038767Family g.83.1.0: automated matches [227235] (1 protein)
    not a true family
  6. 3038768Protein automated matches [226989] (1 species)
    not a true protein
  7. 3038769Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225569] (1 PDB entry)
  8. 3038771Domain d3dxrb_: 3dxr B: [239231]
    automated match to d2bskf1

Details for d3dxrb_

PDB Entry: 3dxr (more details), 2.5 Å

PDB Description: crystal structure of the yeast inter-membrane space chaperone assembly tim9.10
PDB Compounds: (B:) mitochondrial import inner membrane translocase subunit tim10

SCOPe Domain Sequences for d3dxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxrb_ g.83.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqqkiqaaeaeldlvtdmfnklvnncykkcintsysegelnknesscldrcvakyfetnv
qvgenmqkm

SCOPe Domain Coordinates for d3dxrb_:

Click to download the PDB-style file with coordinates for d3dxrb_.
(The format of our PDB-style files is described here.)

Timeline for d3dxrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dxra_