Lineage for d3dxjp3 (3dxj P:319-422)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1480870Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 1480871Protein automated matches [254475] (3 species)
    not a true protein
  7. 1480872Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries)
  8. 1480884Domain d3dxjp3: 3dxj P:319-422 [239230]
    Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxje_, d3dxjf1, d3dxjm_, d3dxjn_, d3dxjo_, d3dxjp1
    automated match to d1smyf2
    protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn

Details for d3dxjp3

PDB Entry: 3dxj (more details), 3 Å

PDB Description: Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
PDB Compounds: (P:) RNA polymerase pricipal sigma factor (RpoD); CHAIN F, P

SCOPe Domain Sequences for d3dxjp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxjp3 a.4.13.0 (P:319-422) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfl

SCOPe Domain Coordinates for d3dxjp3:

Click to download the PDB-style file with coordinates for d3dxjp3.
(The format of our PDB-style files is described here.)

Timeline for d3dxjp3: