Lineage for d1cq3a_ (1cq3 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12375Fold b.27: Soluble secreted chemokine inhibitor, VCCI [49888] (1 superfamily)
  4. 12376Superfamily b.27.1: Soluble secreted chemokine inhibitor, VCCI [49889] (1 family) (S)
  5. 12377Family b.27.1.1: Soluble secreted chemokine inhibitor, VCCI [49890] (1 protein)
  6. 12378Protein Soluble secreted chemokine inhibitor, VCCI [49891] (1 species)
  7. 12379Species Cowpox virus [TaxId:10243] [49892] (1 PDB entry)
  8. 12380Domain d1cq3a_: 1cq3 A: [23923]

Details for d1cq3a_

PDB Entry: 1cq3 (more details), 1.85 Å

PDB Description: structure of a soluble secreted chemokine inhibitor, vcci, from cowpox virus

SCOP Domain Sequences for d1cq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq3a_ b.27.1.1 (A:) Soluble secreted chemokine inhibitor, VCCI {Cowpox virus}
sfssssscteeenkhhmgidviikvtkqdqtptndkicqsvtevtesedeseevvkgdpt
tyytvvgggltmdfgftkcpkissiseysdgntvnarlssvspgqgkdspaitreealsm
ikdcemsinikcseeekdsnikthpvlgsnishkkvsyediigstivdtkcvknleisvr
igdmckesselevkdgfkyvdgsasedaaddtslinsakliacv

SCOP Domain Coordinates for d1cq3a_:

Click to download the PDB-style file with coordinates for d1cq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1cq3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cq3b_