![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
![]() | Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
![]() | Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
![]() | Protein automated matches [254474] (3 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255803] (1 PDB entry) |
![]() | Domain d3dxjp1: 3dxj P:74-257 [239228] Other proteins in same PDB: d3dxjc_, d3dxjd_, d3dxje_, d3dxjf2, d3dxjf3, d3dxjm_, d3dxjn_, d3dxjo_, d3dxjp2, d3dxjp3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with mg, mpd, ne6, po4, zn |
PDB Entry: 3dxj (more details), 3 Å
SCOPe Domain Sequences for d3dxjp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxjp1 a.177.1.1 (P:74-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d3dxjp1: