Lineage for d3dvaj_ (3dva J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725096Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1725097Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1725126Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 1725127Protein automated matches [191291] (4 species)
    not a true protein
  7. 1725128Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries)
  8. 1725130Domain d3dvaj_: 3dva J: [239224]
    Other proteins in same PDB: d3dvaa_, d3dvab1, d3dvab2, d3dvac_, d3dvad1, d3dvad2, d3dvae_, d3dvaf1, d3dvaf2, d3dvag_, d3dvah1, d3dvah2
    automated match to d1w3da_
    complexed with k, mg, tpw

Details for d3dvaj_

PDB Entry: 3dva (more details), 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (J:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d3dvaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvaj_ a.9.1.0 (J:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidafl

SCOPe Domain Coordinates for d3dvaj_:

Click to download the PDB-style file with coordinates for d3dvaj_.
(The format of our PDB-style files is described here.)

Timeline for d3dvaj_: