Class a: All alpha proteins [46456] (289 folds) |
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) |
Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
Protein automated matches [191291] (5 species) not a true protein |
Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries) |
Domain d3dvai_: 3dva I: [239223] Other proteins in same PDB: d3dvaa_, d3dvab1, d3dvab2, d3dvac_, d3dvad1, d3dvad2, d3dvae_, d3dvaf1, d3dvaf2, d3dvag_, d3dvah1, d3dvah2 automated match to d1w3da_ complexed with k, mg, tpw |
PDB Entry: 3dva (more details), 2.35 Å
SCOPe Domain Sequences for d3dvai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dvai_ a.9.1.0 (I:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflag
Timeline for d3dvai_: