![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) ![]() |
![]() | Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
![]() | Protein automated matches [191291] (5 species) not a true protein |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries) |
![]() | Domain d3dv0i_: 3dv0 I: [239221] Other proteins in same PDB: d3dv0a_, d3dv0b1, d3dv0b2, d3dv0c_, d3dv0d1, d3dv0d2, d3dv0e_, d3dv0f1, d3dv0f2, d3dv0g_, d3dv0h1, d3dv0h2 automated match to d1w3da_ complexed with k, mg, pyr, tpw |
PDB Entry: 3dv0 (more details), 2.5 Å
SCOPe Domain Sequences for d3dv0i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dv0i_ a.9.1.0 (I:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} rrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflag
Timeline for d3dv0i_: