Lineage for d3dufj_ (3duf J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697346Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697347Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2697377Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 2697378Protein automated matches [191291] (5 species)
    not a true protein
  7. 2697379Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries)
  8. 2697385Domain d3dufj_: 3duf J: [239220]
    Other proteins in same PDB: d3dufa_, d3dufb1, d3dufb2, d3dufc_, d3dufd1, d3dufd2, d3dufe_, d3duff1, d3duff2, d3dufg_, d3dufh1, d3dufh2
    automated match to d1w3da_
    complexed with k, mg, r1t

Details for d3dufj_

PDB Entry: 3duf (more details), 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (J:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d3dufj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dufj_ a.9.1.0 (J:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
iampsvrkyarekgvdirlvqgtgkngrvlkedida

SCOPe Domain Coordinates for d3dufj_:

Click to download the PDB-style file with coordinates for d3dufj_.
(The format of our PDB-style files is described here.)

Timeline for d3dufj_: