SCOPe 2.08: Domain d3dqvb1: 3dqv B:101-176

Lineage for d3dqvb1 (3dqv B:101-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Nedd8 [54244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
   Uniprot Q15843

8. Domain d3dqvb1: 3dqv B:101-176 [239217]
   Other proteins in same PDB: d3dqva3, d3dqvb2, d3dqvr_, d3dqvy_
   automated match to d3dbhi_
   complexed with zn

Details for d3dqvb1

PDB Entry: 3dqv, 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation

PDB Compounds: (B:) nedd8

SCOPe Domain Sequences for d3dqvb1:

Sequence; same for both SEQRES and ATOM records:

>d3dqvb1 d.15.1.1 (B:101-176) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
imggsvlhlvlalrgg

Timeline for d3dqvb1:

• d3dqvb1 first appeared in SCOPe 2.04, called d3dqvb_
  
• d3dqvb1 appears in SCOPe 2.07