SCOPe 2.06: Domain d3dm2a2: 3dm2 A:430-539

Lineage for d3dm2a2 (3dm2 A:430-539)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)

8. Domain d3dm2a2: 3dm2 A:430-539 [239216]
   Other proteins in same PDB: d3dm2a1, d3dm2b_
   automated match to d1bqna1
   complexed with gwe, po4; mutant

Details for d3dm2a2

PDB Entry: 3dm2, 3.1 Å

PDB Description: crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3dm2a2:

Sequence; same for both SEQRES and ATOM records:

>d3dm2a2 c.55.3.0 (A:430-539) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d3dm2a2:

• d3dm2a2 first appeared in SCOPe 2.04
  
• d3dm2a2 appears in SCOPe 2.05
  
• d3dm2a2 appears in SCOPe 2.07
  
• d3dm2a2 appears in the current release, SCOPe 2.08