| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Nedd8 [54244] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries) Uniprot Q15843 |
| Domain d3dbrl1: 3dbr L:101-176 [239209] Other proteins in same PDB: d3dbra_, d3dbrb1, d3dbrb2, d3dbrc_, d3dbrd1, d3dbrd2, d3dbre_, d3dbrf1, d3dbrf2, d3dbrg_, d3dbrh1, d3dbrh2, d3dbri2, d3dbrj2, d3dbrk2, d3dbrl2 automated match to d3dbhj_ complexed with zn |
PDB Entry: 3dbr (more details), 3.05 Å
SCOPe Domain Sequences for d3dbrl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbrl1 d.15.1.1 (L:101-176) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg
Timeline for d3dbrl1: