SCOPe 2.06: Domain d3dbrj1: 3dbr J:101-176

Lineage for d3dbrj1 (3dbr J:101-176)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families)
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein Nedd8 [54244] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
Uniprot Q15843

Domain d3dbrj1: 3dbr J:101-176 [239207]
Other proteins in same PDB: d3dbra_, d3dbrb1, d3dbrb2, d3dbrc_, d3dbrd1, d3dbrd2, d3dbre_, d3dbrf1, d3dbrf2, d3dbrg_, d3dbrh1, d3dbrh2, d3dbri2, d3dbrj2, d3dbrk2, d3dbrl2
automated match to d3dbhj_
complexed with zn

Details for d3dbrj1

PDB Entry: 3dbr (more details), 3.05 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)

PDB Compounds: (J:) nedd8

SCOPe Domain Sequences for d3dbrj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbrj1 d.15.1.1 (J:101-176) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlrlrgg

SCOPe Domain Coordinates for d3dbrj1:

Click to download the PDB-style file with coordinates for d3dbrj1.
(The format of our PDB-style files is described here.)

Timeline for d3dbrj1: