SCOPe 2.08: Domain d3czub_: 3czu B:

Lineage for d3czub_ (3czu B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)

8. Domain d3czub_: 3czu B: [239200]
   Other proteins in same PDB: d3czua_
   automated match to d1shxa_

Details for d3czub_

PDB Entry: 3czu, 2.65 Å

PDB Description: crystal structure of the human ephrin a2- ephrin a1 complex

PDB Compounds: (B:) Ephrin-A1

SCOPe Domain Sequences for d3czub_:

Sequence, based on SEQRES records:

>d3czub_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey
qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe
drclrlkvtvsg

Sequence, based on observed residues (ATOM records):

>d3czub_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyesvadaameqyilylveheeyql
cqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhedr
clrlkvtvsg

Timeline for d3czub_:

• d3czub_ first appeared in SCOPe 2.04
  
• d3czub_ appears in SCOPe 2.07