Lineage for d3czub_ (3czu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772512Domain d3czub_: 3czu B: [239200]
    Other proteins in same PDB: d3czua_
    automated match to d1shxa_

Details for d3czub_

PDB Entry: 3czu (more details), 2.65 Å

PDB Description: crystal structure of the human ephrin a2- ephrin a1 complex
PDB Compounds: (B:) Ephrin-A1

SCOPe Domain Sequences for d3czub_:

Sequence, based on SEQRES records: (download)

>d3czub_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey
qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe
drclrlkvtvsg

Sequence, based on observed residues (ATOM records): (download)

>d3czub_ b.6.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyesvadaameqyilylveheeyql
cqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhedr
clrlkvtvsg

SCOPe Domain Coordinates for d3czub_:

Click to download the PDB-style file with coordinates for d3czub_.
(The format of our PDB-style files is described here.)

Timeline for d3czub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3czua_