Lineage for d3cw2f1 (3cw2 F:2-206)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476854Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries)
  8. 2476869Domain d3cw2f1: 3cw2 F:2-206 [239197]
    Other proteins in same PDB: d3cw2a2, d3cw2a3, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e2, d3cw2e3, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3
    automated match to d2qn6a3

Details for d3cw2f1

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (F:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3cw2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2f1 c.37.1.8 (F:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d3cw2f1:

Click to download the PDB-style file with coordinates for d3cw2f1.
(The format of our PDB-style files is described here.)

Timeline for d3cw2f1: