Lineage for d3cw2e2 (3cw2 E:207-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2063052Species Sulfolobus solfataricus [TaxId:2287] [255782] (5 PDB entries)
  8. 2063065Domain d3cw2e2: 3cw2 E:207-320 [239195]
    Other proteins in same PDB: d3cw2a1, d3cw2a3, d3cw2b1, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e3, d3cw2f1, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3
    automated match to d2qn6a1

Details for d3cw2e2

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (E:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3cw2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2e2 b.43.3.0 (E:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d3cw2e2:

Click to download the PDB-style file with coordinates for d3cw2e2.
(The format of our PDB-style files is described here.)

Timeline for d3cw2e2: