| Class b: All beta proteins [48724] (178 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
| Protein automated matches [226946] (29 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [255782] (6 PDB entries) |
| Domain d3cw2b2: 3cw2 B:207-320 [239192] Other proteins in same PDB: d3cw2a1, d3cw2a3, d3cw2b1, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e3, d3cw2f1, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3 automated match to d2qn6a1 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw2b2 b.43.3.0 (B:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad
Timeline for d3cw2b2: