Lineage for d3cw2a3 (3cw2 A:321-415)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403547Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2403548Protein automated matches [254425] (18 species)
    not a true protein
  7. 2403612Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries)
  8. 2403624Domain d3cw2a3: 3cw2 A:321-415 [239190]
    Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2b1, d3cw2b2, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2f1, d3cw2f2, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3
    automated match to d2qn6a2

Details for d3cw2a3

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3cw2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2a3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d3cw2a3:

Click to download the PDB-style file with coordinates for d3cw2a3.
(The format of our PDB-style files is described here.)

Timeline for d3cw2a3: