Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries) |
Domain d3cika3: 3cik A:550-669 [239183] Other proteins in same PDB: d3cika1, d3cika2, d3cikb_, d3cikg_ automated match to d1omwa2 complexed with mg |
PDB Entry: 3cik (more details), 2.75 Å
SCOPe Domain Sequences for d3cika3:
Sequence, based on SEQRES records: (download)
>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedyalgkdcimhgymskmtqwqrryfylfpnrlewrgegeapqslltmeeiqsveetqi kerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr
Timeline for d3cika3: