Lineage for d3c75l_ (3c75 L:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261162Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2261163Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2261164Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2261221Protein automated matches [190303] (3 species)
    not a true protein
  7. 2261259Species Paracoccus versutus [TaxId:34007] [255772] (1 PDB entry)
  8. 2261260Domain d3c75l_: 3c75 L: [239179]
    Other proteins in same PDB: d3c75a_, d3c75b_
    automated match to d4fa9e_
    complexed with cu

Details for d3c75l_

PDB Entry: 3c75 (more details), 2.5 Å

PDB Description: Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
PDB Compounds: (L:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3c75l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c75l_ g.21.1.1 (L:) automated matches {Paracoccus versutus [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3c75l_:

Click to download the PDB-style file with coordinates for d3c75l_.
(The format of our PDB-style files is described here.)

Timeline for d3c75l_: