Class g: Small proteins [56992] (92 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus versutus [TaxId:34007] [255772] (1 PDB entry) |
Domain d3c75l_: 3c75 L: [239179] Other proteins in same PDB: d3c75a_, d3c75b_ automated match to d4fa9e_ complexed with cu |
PDB Entry: 3c75 (more details), 2.5 Å
SCOPe Domain Sequences for d3c75l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c75l_ g.21.1.1 (L:) automated matches {Paracoccus versutus [TaxId: 34007]} vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3c75l_: