Lineage for d3c60f1 (3c60 F:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761292Domain d3c60f1: 3c60 F:1-111 [239177]
    Other proteins in same PDB: d3c60a2, d3c60b2, d3c60c1, d3c60c2, d3c60d1, d3c60d2, d3c60e2, d3c60f2, d3c60g1, d3c60g2, d3c60h1, d3c60h2
    automated match to d2ak4e1

Details for d3c60f1

PDB Entry: 3c60 (more details), 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62
PDB Compounds: (F:) TCR YAe62 beta chain

SCOPe Domain Sequences for d3c60f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c60f1 b.1.1.0 (F:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle

SCOPe Domain Coordinates for d3c60f1:

Click to download the PDB-style file with coordinates for d3c60f1.
(The format of our PDB-style files is described here.)

Timeline for d3c60f1: