![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d3c60b2: 3c60 B:112-236 [239174] Other proteins in same PDB: d3c60a1, d3c60b1, d3c60c1, d3c60c2, d3c60d1, d3c60d2, d3c60e1, d3c60f1, d3c60g1, d3c60g2, d3c60h1, d3c60h2 automated match to d2esve2 |
PDB Entry: 3c60 (more details), 3.05 Å
SCOPe Domain Sequences for d3c60b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c60b2 b.1.1.2 (B:112-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeaw
Timeline for d3c60b2: