Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d3c60b1: 3c60 B:1-111 [239173] Other proteins in same PDB: d3c60a2, d3c60b2, d3c60c1, d3c60c2, d3c60d1, d3c60d2, d3c60e2, d3c60f2, d3c60g1, d3c60g2, d3c60h1, d3c60h2 automated match to d2ak4e1 |
PDB Entry: 3c60 (more details), 3.05 Å
SCOPe Domain Sequences for d3c60b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c60b1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle
Timeline for d3c60b1: