SCOPe 2.08: Domain d1g6gb_: 1g6g B:

Lineage for d1g6gb_ (1g6g B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)

8. Domain d1g6gb_: 1g6g B: [23917]
   complexed with a phosphothreonine peptide

Details for d1g6gb_

PDB Entry: 1g6g, 1.6 Å

PDB Description: x-ray structure of the n-terminal fha domain from s. cerevisiae rad53p in complex with a phosphothreonine peptide at 1.6 a resolution

PDB Compounds: (B:) protein kinase rad53

SCOPe Domain Sequences for d1g6gb_:

Sequence; same for both SEQRES and ATOM records:

>d1g6gb_ b.26.1.2 (B:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpacdyhlgnisrlsnkhfqi
llgedgnlllndistngtwlngqkveknsnqllsqgdeitvgvgvesdilslvifindkf
kqcl

Timeline for d1g6gb_:

• d1g6gb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g6gb_ appears in SCOPe 2.07