Lineage for d3bt6b_ (3bt6 B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2592020Species Influenza B virus [TaxId:11520] [255766] (1 PDB entry)
  8. 2592021Domain d3bt6b_: 3bt6 B: [239168]
    Other proteins in same PDB: d3bt6a_
    automated match to d1ti8b1
    complexed with nag, ndg, so4

Details for d3bt6b_

PDB Entry: 3bt6 (more details), 2.8 Å

PDB Description: Crystal Structure of Influenza B Virus Hemagglutinin
PDB Compounds: (B:) Influenza B hemagglutinin (HA)

SCOPe Domain Sequences for d3bt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt6b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza B virus [TaxId: 11520]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfds

SCOPe Domain Coordinates for d3bt6b_:

Click to download the PDB-style file with coordinates for d3bt6b_.
(The format of our PDB-style files is described here.)

Timeline for d3bt6b_: