SCOPe 2.05: Domain d3bquc2: 3bqu C:108-209

Lineage for d3bquc2 (3bqu C:108-209)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3bquc2: 3bqu C:108-209 [239167]
   Other proteins in same PDB: d3bqua1, d3bqua2, d3bqud1
   automated match to d3u7yl2
   complexed with so4

Details for d3bquc2

PDB Entry: 3bqu, 3 Å

PDB Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex

PDB Compounds: (C:) 3H6 Fab light chain

SCOPe Domain Sequences for d3bquc2:

Sequence, based on SEQRES records:

>d3bquc2 b.1.1.0 (C:108-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksf

Sequence, based on observed residues (ATOM records):

>d3bquc2 b.1.1.0 (C:108-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidngvlnswtdqdskdst
ysmsstltltkdeyerhnsytceathkspivksf

Timeline for d3bquc2:

• d3bquc2 first appeared in SCOPe 2.04
  
• d3bquc2 appears in SCOPe 2.06
  
• d3bquc2 appears in the current release, SCOPe 2.08