Lineage for d3bquc2 (3bqu C:108-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761131Domain d3bquc2: 3bqu C:108-209 [239167]
    Other proteins in same PDB: d3bqua1, d3bqua2, d3bqud1
    automated match to d3u7yl2
    complexed with so4

Details for d3bquc2

PDB Entry: 3bqu (more details), 3 Å

PDB Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex
PDB Compounds: (C:) 3H6 Fab light chain

SCOPe Domain Sequences for d3bquc2:

Sequence, based on SEQRES records: (download)

>d3bquc2 b.1.1.0 (C:108-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksf

Sequence, based on observed residues (ATOM records): (download)

>d3bquc2 b.1.1.0 (C:108-209) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidngvlnswtdqdskdst
ysmsstltltkdeyerhnsytceathkspivksf

SCOPe Domain Coordinates for d3bquc2:

Click to download the PDB-style file with coordinates for d3bquc2.
(The format of our PDB-style files is described here.)

Timeline for d3bquc2: