Lineage for d3bqua2 (3bqu A:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752102Domain d3bqua2: 3bqu A:108-211 [239165]
    Other proteins in same PDB: d3bqua1, d3bquc1, d3bquc2, d3bqud1
    automated match to d2f5al2
    complexed with so4

Details for d3bqua2

PDB Entry: 3bqu (more details), 3 Å

PDB Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex
PDB Compounds: (A:) 2F5 Fab' light chain

SCOPe Domain Sequences for d3bqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqua2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnr

SCOPe Domain Coordinates for d3bqua2:

Click to download the PDB-style file with coordinates for d3bqua2.
(The format of our PDB-style files is described here.)

Timeline for d3bqua2: