| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (32 PDB entries) |
| Domain d3bpnb1: 3bpn B:2-96 [239162] Other proteins in same PDB: d3bpna_, d3bpnb3 automated match to d3bplb1 complexed with nag |
PDB Entry: 3bpn (more details), 3.02 Å
SCOPe Domain Sequences for d3bpnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpnb1 b.1.2.1 (B:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvlqeptcvsdymsistcewkmngptqcstelrllyqlvfllseahtcipennggagcvc
hllmddvvsadqytldlwagqqllwkgsfkpsehv
Timeline for d3bpnb1: