Lineage for d3bgib_ (3bgi B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130202Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
    automatically mapped to Pfam PF05724
  6. 2130203Protein Thiopurine S-methyltransferase [102567] (3 species)
  7. 2130208Species Mouse (Mus musculus) [TaxId:10090] [225137] (3 PDB entries)
  8. 2130212Domain d3bgib_: 3bgi B: [239161]
    automated match to d3bgdb_
    complexed with sah

Details for d3bgib_

PDB Entry: 3bgi (more details), 1.8 Å

PDB Description: thiopurine s-methyltransferase
PDB Compounds: (B:) thiopurine s-methyltransferase

SCOPe Domain Sequences for d3bgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bgib_ c.66.1.36 (B:) Thiopurine S-methyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
daevqknqvltledwkekwvtrhisfhqeqghqllkkhldtflkgqsglrvffplcgkai
emkwfadrghtvvgveiseigireffaeqnlsyteeplaeiagakvfksssgsislyccs
ifdlpranigkfdriwdrgalvainpgdhdryadiilsllrkefqylvavlsydptkhag
ppfyvpsaelkrlfgtkcsmqcleevdaleerhkawgldylfeklylltek

SCOPe Domain Coordinates for d3bgib_:

Click to download the PDB-style file with coordinates for d3bgib_.
(The format of our PDB-style files is described here.)

Timeline for d3bgib_: