SCOPe 2.08: Domain d3bgib_: 3bgi B:

Lineage for d3bgib_ (3bgi B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
   automatically mapped to Pfam PF05724

6. Protein Thiopurine S-methyltransferase [102567] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [225137] (3 PDB entries)

8. Domain d3bgib_: 3bgi B: [239161]
   automated match to d3bgdb_
   complexed with sah

Details for d3bgib_

PDB Entry: 3bgi, 1.8 Å

PDB Description: thiopurine s-methyltransferase

PDB Compounds: (B:) thiopurine s-methyltransferase

SCOPe Domain Sequences for d3bgib_:

Sequence; same for both SEQRES and ATOM records:

>d3bgib_ c.66.1.36 (B:) Thiopurine S-methyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
daevqknqvltledwkekwvtrhisfhqeqghqllkkhldtflkgqsglrvffplcgkai
emkwfadrghtvvgveiseigireffaeqnlsyteeplaeiagakvfksssgsislyccs
ifdlpranigkfdriwdrgalvainpgdhdryadiilsllrkefqylvavlsydptkhag
ppfyvpsaelkrlfgtkcsmqcleevdaleerhkawgldylfeklylltek

Timeline for d3bgib_:

• d3bgib_ first appeared in SCOPe 2.04
  
• d3bgib_ appears in SCOPe 2.07