SCOP 1.57: Domain d1g6ga_: 1g6g A:

Lineage for d1g6ga_ (1g6g A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)

4. Superfamily b.26.1: SMAD/FHA domain [49879] (2 families)

5. Family b.26.1.2: FHA domain [49885] (1 protein)

6. Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (6 PDB entries)

8. Domain d1g6ga_: 1g6g A: [23916]

Details for d1g6ga_

PDB Entry: 1g6g, 1.6 Å

PDB Description: x-ray structure of the n-terminal fha domain from s. cerevisiae rad53p in complex with a phosphothreonine peptide at 1.6 a resolution

SCOP Domain Sequences for d1g6ga_:

Sequence; same for both SEQRES and ATOM records:

>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae)}
genivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpacdyhlgnisrlsnkh
fqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvgvgvesdilslvifin
dkfkqcl

Timeline for d1g6ga_:

• d1g6ga_ first appeared (with stable ids) in SCOP 1.55
  
• d1g6ga_ appears in SCOP 1.59
  
• d1g6ga_ appears in the current release, SCOPe 2.08