![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
![]() | Protein automated matches [232407] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [232408] (7 PDB entries) |
![]() | Domain d3be1a2: 3be1 A:165-321 [239158] Other proteins in same PDB: d3be1a1, d3be1a3, d3be1l1, d3be1l2 automated match to d1n8yc3 complexed with mes, nag |
PDB Entry: 3be1 (more details), 2.9 Å
SCOPe Domain Sequences for d3be1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3be1a2 g.3.9.0 (A:165-321) automated matches {Human (Homo sapiens) [TaxId: 9606]} nrsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctg pkhsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylst dvgsctlvcplhnqevtaedgtqrcekcskpcarvcy
Timeline for d3be1a2: