Lineage for d3be1a1 (3be1 A:1-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1584080Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1584081Protein automated matches [190787] (7 species)
    not a true protein
  7. 1584082Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries)
  8. 1584101Domain d3be1a1: 3be1 A:1-164 [239157]
    Other proteins in same PDB: d3be1a2, d3be1a4, d3be1l1, d3be1l2
    automated match to d1n8yc1
    complexed with mes, nag

Details for d3be1a1

PDB Entry: 3be1 (more details), 2.9 Å

PDB Description: dual specific bh1 fab in complex with the extracellular domain of her2/erbb-2
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3be1a1:

Sequence, based on SEQRES records: (download)

>d3be1a1 c.10.2.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidt

Sequence, based on observed residues (ATOM records): (download)

>d3be1a1 c.10.2.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdpspgglrelqlrslteilkgg
vliqrnpqlcyqdtilwkdifhknnqlaltlidt

SCOPe Domain Coordinates for d3be1a1:

Click to download the PDB-style file with coordinates for d3be1a1.
(The format of our PDB-style files is described here.)

Timeline for d3be1a1: