SCOPe 2.04: Domain d3b5ng_: 3b5n G:

Lineage for d3b5ng_ (3b5n G:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein automated matches [254664] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255760] (1 PDB entry)

8. Domain d3b5ng_: 3b5n G: [239155]
   Other proteins in same PDB: d3b5na_, d3b5nb_, d3b5ne_, d3b5nf_, d3b5nj1
   automated match to d1urqc_

Details for d3b5ng_

PDB Entry: 3b5n, 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex

PDB Compounds: (G:) Protein transport protein SEC9

SCOPe Domain Sequences for d3b5ng_:

Sequence; same for both SEQRES and ATOM records:

>d3b5ng_ h.1.15.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsikftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvad
ekvaelkkl

Timeline for d3b5ng_:

• d3b5ng_ is new in SCOPe 2.04-stable
  
• d3b5ng_ appears in SCOPe 2.05
  
• d3b5ng_ appears in the current release, SCOPe 2.08, called d3b5ng1