Lineage for d3azmc_ (3azm C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1726113Protein automated matches [193445] (6 species)
    not a true protein
  7. 1726148Species Human (Homo sapiens) [TaxId:9606] [193446] (28 PDB entries)
  8. 1726227Domain d3azmc_: 3azm C: [239150]
    Other proteins in same PDB: d3azme_
    automated match to d2pyoc_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azmc_

PDB Entry: 3azm (more details), 2.89 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K79Q mutation
PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d3azmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azmc_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d3azmc_:

Click to download the PDB-style file with coordinates for d3azmc_.
(The format of our PDB-style files is described here.)

Timeline for d3azmc_: