![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
![]() | Domain d3azlg_: 3azl G: [239148] Other proteins in same PDB: d3azla_ automated match to d2pyoc_ protein/DNA complex; complexed with cl, mn; mutant |
PDB Entry: 3azl (more details), 2.7 Å
SCOPe Domain Sequences for d3azlg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azlg_ a.22.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardn kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d3azlg_: